Lineage for d1ft2a_ (1ft2 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50668Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 50669Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 50670Protein Protein farnesyltransferase alpha-subunit [48441] (1 species)
  7. 50671Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (6 PDB entries)
  8. 50677Domain d1ft2a_: 1ft2 A: [19190]
    Other proteins in same PDB: d1ft2b_

Details for d1ft2a_

PDB Entry: 1ft2 (more details), 3.4 Å

PDB Description: co-crystal structure of protein farnesyltransferase complexed with a farnesyl diphosphate substrate

SCOP Domain Sequences for d1ft2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft2a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhsr

SCOP Domain Coordinates for d1ft2a_:

Click to download the PDB-style file with coordinates for d1ft2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ft2a_: