Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin K [54028] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries) Uniprot P43235 116-329 ! Uniprot P43235 115-329 |
Domain d3kx1a_: 3kx1 A: [191892] automated match to d2r6na1 complexed with kx1, so4 |
PDB Entry: 3kx1 (more details), 1.51 Å
SCOPe Domain Sequences for d3kx1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kx1a_ d.3.1.1 (A:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} dsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsendg cgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekalk ravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiikn swgenwgnkgyilmarnknnacgianlasfpkm
Timeline for d3kx1a_: