SCOPe 2.08: Domain d3kwby_: 3kwb Y:

Lineage for d3kwby_ (3kwb Y:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin K [54028] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54029] (56 PDB entries)
   Uniprot P43235 116-329 ! Uniprot P43235 115-329

8. Domain d3kwby_: 3kwb Y: [191890]
   automated match to d2r6na1
   complexed with orh

Details for d3kwby_

PDB Entry: 3kwb, 2.02 Å

PDB Description: Structure of CatK covalently bound to a dioxo-triazine inhibitor

PDB Compounds: (Y:) cathepsin k

SCOPe Domain Sequences for d3kwby_:

Sequence; same for both SEQRES and ATOM records:

>d3kwby_ d.3.1.1 (Y:) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
dyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsendgcgg
gymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegnekalkrav
arvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwiiknswg
enwgnkgyilmarnknnacgianlasfpkm

Timeline for d3kwby_:

• d3kwby_ first appeared in SCOPe 2.02
  
• d3kwby_ appears in SCOPe 2.07