Lineage for d1qbqa_ (1qbq A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50668Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 50669Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 50670Protein Protein farnesyltransferase alpha-subunit [48441] (1 species)
  7. 50671Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (6 PDB entries)
  8. 50674Domain d1qbqa_: 1qbq A: [19187]
    Other proteins in same PDB: d1qbqb_

Details for d1qbqa_

PDB Entry: 1qbq (more details), 2.4 Å

PDB Description: structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.

SCOP Domain Sequences for d1qbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbqa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqsk

SCOP Domain Coordinates for d1qbqa_:

Click to download the PDB-style file with coordinates for d1qbqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qbqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qbqb_