Lineage for d3dcwa_ (3dcw A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136597Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1136598Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1136599Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 1136600Protein Carbonic anhydrase [51071] (10 species)
  7. 1136632Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (419 PDB entries)
    Uniprot P00918
  8. 1136728Domain d3dcwa_: 3dcw A: [191862]
    automated match to d2foua_
    complexed with ezl, zn

Details for d3dcwa_

PDB Entry: 3dcw (more details), 1.5 Å

PDB Description: use of carbonic anhydrase ii, ix active-site mimic, for the purpose of screening inhibitors for possible anti-cancer properties
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d3dcwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dcwa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d3dcwa_:

Click to download the PDB-style file with coordinates for d3dcwa_.
(The format of our PDB-style files is described here.)

Timeline for d3dcwa_: