Lineage for d3ax4a_ (3ax4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779036Species Dioclea violacea [TaxId:192415] [187744] (2 PDB entries)
  8. 2779041Domain d3ax4a_: 3ax4 A: [191858]
    automated match to d2gdfa_
    complexed with ca, mn, xmm

Details for d3ax4a_

PDB Entry: 3ax4 (more details), 2.61 Å

PDB Description: three-dimensional structure of lectin from dioclea violacea and comparative vasorelaxant effects with dioclea rostrata
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d3ax4a_:

Sequence, based on SEQRES records: (download)

>d3ax4a_ b.29.1.1 (A:) automated matches {Dioclea violacea [TaxId: 192415]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsa
adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d3ax4a_ b.29.1.1 (A:) automated matches {Dioclea violacea [TaxId: 192415]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktens
lhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsssgdpqgnsvgralfyapvhiweks
avvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d3ax4a_:

Click to download the PDB-style file with coordinates for d3ax4a_.
(The format of our PDB-style files is described here.)

Timeline for d3ax4a_: