Lineage for d3altd_ (3alt D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002302Species Cucumaria echinata [TaxId:40245] [189610] (3 PDB entries)
  8. 3002310Domain d3altd_: 3alt D: [191844]
    automated match to d3alud_
    complexed with ca

Details for d3altd_

PDB Entry: 3alt (more details), 2.5 Å

PDB Description: crystal structure of cel-iv complexed with melibiose
PDB Compounds: (D:) Lectin CEL-IV, C-type

SCOPe Domain Sequences for d3altd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3altd_ d.169.1.0 (D:) automated matches {Cucumaria echinata [TaxId: 40245]}
ltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesqa
fltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpnsr
gaiaagdysrgfwadvysnnnfkyicqlpcvhytle

SCOPe Domain Coordinates for d3altd_:

Click to download the PDB-style file with coordinates for d3altd_.
(The format of our PDB-style files is described here.)

Timeline for d3altd_: