Lineage for d1qsaa1 (1qsa A:1-450)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6181Superfamily a.118.5: Bacterial muramidases [48435] (1 family) (S)
  5. 6182Family a.118.5.1: Bacterial muramidases [48436] (1 protein)
  6. 6183Protein 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain [48437] (1 species)
  7. 6184Species Escherichia coli [TaxId:562] [48438] (3 PDB entries)
  8. 6185Domain d1qsaa1: 1qsa A:1-450 [19182]
    Other proteins in same PDB: d1qsaa2

Details for d1qsaa1

PDB Entry: 1qsa (more details), 1.65 Å

PDB Description: crystal structure of the 70 kda soluble lytic transglycosylase slt70 from escherichia coli at 1.65 angstroms resolution

SCOP Domain Sequences for d1qsaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli}
dsldeqrsryaqikqawdnrqmdvveqmmpglkdyplypyleyrqitddlmnqpavtvtn
fvranptlppartlqsrfvnelarredwrgllafspekpgtteaqcnyyyakwntgqsee
awqgakelwltgksqpnacdklfsvwrasgkqdplaylerirlamkagntglvtvlagqm
padyqtiasaiislannpntvltfarttgatdftrqmaavafasvarqdaenarlmipsl
aqaqqlnedqiqelrdivawrlmgndvtdeqakwrddaimrsqstslierrvrmalgtgd
rrglntwlarlpmeakekdewrywqadlllergreaeakeilhqlmqqrgfypmvaaqri
geeyelkidkapqnvdsaltqgpemarvrelmywnldntarsewanlvkskskteqaqla
ryafnnqwwdlsvqatiagklwdhleerfp

SCOP Domain Coordinates for d1qsaa1:

Click to download the PDB-style file with coordinates for d1qsaa1.
(The format of our PDB-style files is described here.)

Timeline for d1qsaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qsaa2