SCOPe 2.06: Domain d3qjvc_: 3qjv C:

Lineage for d3qjvc_ (3qjv C:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family)
   automatically mapped to Pfam PF08113

5. Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
   functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II

7. Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries)

8. Domain d3qjvc_: 3qjv C: [191815]
   Other proteins in same PDB: d3qjva_, d3qjvb1, d3qjvb2
   automated match to d1xmec1
   complexed with cmo, cu1, cua, has, hem

Details for d3qjvc_

PDB Entry: 3qjv, 2.8 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus

PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d3qjvc_:

Sequence; same for both SEQRES and ATOM records:

>d3qjvc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

Timeline for d3qjvc_:

• d3qjvc_ first appeared in SCOPe 2.02
  
• d3qjvc_ appears in SCOPe 2.05
  
• d3qjvc_ appears in SCOPe 2.07
  
• d3qjvc_ appears in the current release, SCOPe 2.08