![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) ![]() automatically mapped to Pfam PF08113 |
![]() | Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins) |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
![]() | Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries) |
![]() | Domain d3qjtc_: 3qjt C: [191813] Other proteins in same PDB: d3qjta_, d3qjtb1, d3qjtb2 automated match to d1xmec1 complexed with cmo, cu1, cua, has, hem |
PDB Entry: 3qjt (more details), 2.95 Å
SCOPe Domain Sequences for d3qjtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjtc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} eekpkgalavilvltltilvfwlgvyavffarg
Timeline for d3qjtc_: