SCOPe 2.03: Domain d3qjtc_: 3qjt C:

Lineage for d3qjtc_ (3qjt C:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family)
   automatically mapped to Pfam PF08113

5. Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
   functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II

7. Species Thermus thermophilus [TaxId:274] [81470] (23 PDB entries)

8. Domain d3qjtc_: 3qjt C: [191813]
   Other proteins in same PDB: d3qjta_, d3qjtb1, d3qjtb2
   automated match to d1xmec1
   complexed with cmo, cu1, cua, has, hem

Details for d3qjtc_

PDB Entry: 3qjt, 2.95 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus

PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d3qjtc_:

Sequence; same for both SEQRES and ATOM records:

>d3qjtc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

Timeline for d3qjtc_:

• d3qjtc_ first appeared in SCOPe 2.02
  
• d3qjtc_ appears in SCOPe 2.04
  
• d3qjtc_ appears in the current release, SCOPe 2.08