Lineage for d3qjsc_ (3qjs C:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457025Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 1457026Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein)
  6. 1457027Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 1457028Species Thermus thermophilus [TaxId:274] [81470] (23 PDB entries)
  8. 1457043Domain d3qjsc_: 3qjs C: [191812]
    Other proteins in same PDB: d3qjsa_, d3qjsb1, d3qjsb2
    automated match to d1xmec1
    complexed with cmo, cu1, cua, has, hem

Details for d3qjsc_

PDB Entry: 3qjs (more details), 2.8 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d3qjsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjsc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d3qjsc_:

Click to download the PDB-style file with coordinates for d3qjsc_.
(The format of our PDB-style files is described here.)

Timeline for d3qjsc_: