![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) ![]() |
![]() | Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein) |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species) functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II |
![]() | Species Thermus thermophilus [TaxId:274] [81470] (19 PDB entries) |
![]() | Domain d3qjqc_: 3qjq C: [191811] Other proteins in same PDB: d3qjqa_ automated match to d1xmec1 complexed with cmo, cu1, cua, has, hem |
PDB Entry: 3qjq (more details), 2.9 Å
SCOPe Domain Sequences for d3qjqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjqc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]} eekpkgalavilvltltilvfwlgvyavffarg
Timeline for d3qjqc_: