Lineage for d3nzjr_ (3nzj R:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223777Protein automated matches [190144] (8 species)
    not a true protein
  7. 1223798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries)
  8. 1223810Domain d3nzjr_: 3nzj R: [191795]
    Other proteins in same PDB: d3nzja_, d3nzje_, d3nzji_, d3nzjj_, d3nzjo_, d3nzjs_, d3nzjw_, d3nzjx_
    automated match to d1jd2y_
    complexed with mes

Details for d3nzjr_

PDB Entry: 3nzj (more details), 2.4 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with ligand 2a
PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d3nzjr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzjr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3nzjr_:

Click to download the PDB-style file with coordinates for d3nzjr_.
(The format of our PDB-style files is described here.)

Timeline for d3nzjr_: