Lineage for d3hy9b1 (3hy9 B:262-480)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530260Domain d3hy9b1: 3hy9 B:262-480 [191740]
    Other proteins in same PDB: d3hy9b2
    automated match to d3b8za_
    complexed with 098, ca, zn

Details for d3hy9b1

PDB Entry: 3hy9 (more details), 2.02 Å

PDB Description: crystal structure of the catalytic domain of adamts-5 in complex with an amino-2-indanol compound
PDB Compounds: (B:) Catalytic Domain of ADAMTS-5

SCOPe Domain Sequences for d3hy9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hy9b1 d.92.1.0 (B:262-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvvl
gdkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlgm
advgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlmss
iltsidaskpwskctsatiteflddghgnclldlprkqi

SCOPe Domain Coordinates for d3hy9b1:

Click to download the PDB-style file with coordinates for d3hy9b1.
(The format of our PDB-style files is described here.)

Timeline for d3hy9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hy9b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hy9a_