Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (43 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [189249] (1 PDB entry) |
Domain d3gdjc_: 3gdj C: [191712] automated match to d3gdja_ complexed with hem |
PDB Entry: 3gdj (more details), 2 Å
SCOPe Domain Sequences for d3gdjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gdjc_ a.1.1.2 (C:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} vlsskdktnvktafgkigghaaeygaealermflgfpttktyfphfdlshgsaqvkahgk kvgdaltkaadhlddlpsalsalsdlhahklrvdpvnfkllshcllvtvaahhpgdftps vhasldkflanvstvltskyr
Timeline for d3gdjc_: