Lineage for d3bz1z_ (3bz1 Z:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629660Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 2629661Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2629662Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2629663Species Thermosynechococcus elongatus [TaxId:146786] [161058] (9 PDB entries)
    Uniprot Q8DHJ2 1-62
  8. 2629671Domain d3bz1z_: 3bz1 Z: [191701]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1z_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d3bz1z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1z_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d3bz1z_:

Click to download the PDB-style file with coordinates for d3bz1z_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1z_: