Lineage for d1ap7__ (1ap7 -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) 
Protein Cell cycle inhibitor p16ink4A [48414] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [48416] (1 PDB entry) 
Domain d1ap7__: 1ap7 - [19170]
Details for d1ap7__
PDB Entry: 1ap7 (more details)
PDB Description: p19-ink4d from mouse, nmr, 20 structures
SCOP Domain Sequences for d1ap7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ap7__ a.118.2.1 (-) Cell cycle inhibitor p16ink4A {Mouse (Mus musculus)}
gsmlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspaval
ellkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireg
hssvvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm
SCOP Domain Coordinates for d1ap7__:
Click to download the PDB-style file with coordinates for d1ap7__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ap7__:
- d1ap7__ first appeared (with stable ids) in SCOP 1.55
- d1ap7__ appears in SCOP 1.59
- d1ap7__ appears in the current release, SCOPe 2.08, called d1ap7a_
View in 3D