Lineage for d3bdmd_ (3bdm D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678282Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)
  8. 1678427Domain d3bdmd_: 3bdm D: [191698]
    Other proteins in same PDB: d3bdm0_, d3bdm1_, d3bdma_, d3bdme_, d3bdmf_, d3bdmi_, d3bdmj_, d3bdmk_, d3bdmm_, d3bdmn_, d3bdmo_, d3bdms_, d3bdmt_, d3bdmw_, d3bdmx_, d3bdmy_
    automated match to d1jd2y_
    complexed with gdt

Details for d3bdmd_

PDB Entry: 3bdm (more details), 2.7 Å

PDB Description: yeast 20S proteasome:glidobactin A-complex
PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d3bdmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdmd_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d3bdmd_:

Click to download the PDB-style file with coordinates for d3bdmd_.
(The format of our PDB-style files is described here.)

Timeline for d3bdmd_: