SCOPe 2.06: Domain d3alua_: 3alu A:

Lineage for d3alua_ (3alu A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Cucumaria echinata [TaxId:40245] [189610] (3 PDB entries)

8. Domain d3alua_: 3alu A: [191693]
   automated match to d3alud_
   complexed with ca, edo, raf

Details for d3alua_

PDB Entry: 3alu, 1.65 Å

PDB Description: crystal structure of cel-iv complexed with raffinose

PDB Compounds: (A:) Lectin CEL-IV, C-type

SCOPe Domain Sequences for d3alua_:

Sequence; same for both SEQRES and ATOM records:

>d3alua_ d.169.1.0 (A:) automated matches {Cucumaria echinata [TaxId: 40245]}
cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle

Timeline for d3alua_:

• d3alua_ first appeared in SCOPe 2.02
  
• d3alua_ appears in SCOPe 2.05
  
• d3alua_ appears in SCOPe 2.07
  
• d3alua_ appears in the current release, SCOPe 2.08