Lineage for d2zcyr_ (2zcy R:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1223777Protein automated matches [190144] (8 species)
    not a true protein
  7. 1223798Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries)
  8. 1223885Domain d2zcyr_: 2zcy R: [191690]
    Other proteins in same PDB: d2zcy01, d2zcy1_, d2zcya_, d2zcye_, d2zcyf1, d2zcyi_, d2zcyj_, d2zcyk_, d2zcym1, d2zcyn_, d2zcyo_, d2zcys_, d2zcyt1, d2zcyw_, d2zcyx_, d2zcyy_
    automated match to d1jd2y_
    complexed with srg

Details for d2zcyr_

PDB Entry: 2zcy (more details), 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex
PDB Compounds: (R:) Proteasome component PUP2

SCOPe Domain Sequences for d2zcyr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zcyr_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOPe Domain Coordinates for d2zcyr_:

Click to download the PDB-style file with coordinates for d2zcyr_.
(The format of our PDB-style files is described here.)

Timeline for d2zcyr_: