Lineage for d1dc2a_ (1dc2 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50602Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 50603Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)
  6. 50607Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. 50608Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)
  8. 50611Domain d1dc2a_: 1dc2 A: [19168]

Details for d1dc2a_

PDB Entry: 1dc2 (more details)

PDB Description: solution nmr structure of tumor suppressor p16ink4a, 20 structures

SCOP Domain Sequences for d1dc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc2a_ a.118.2.1 (A:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens)}
mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
lghrdvarylraaaggtrgsnharidaaegpsdipd

SCOP Domain Coordinates for d1dc2a_:

Click to download the PDB-style file with coordinates for d1dc2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dc2a_: