Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Cell cycle inhibitor p16ink4A [48414] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries) |
Domain d2a5ea_: 2a5e A: [19167] |
PDB Entry: 2a5e (more details)
SCOPe Domain Sequences for d2a5ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5ea_ d.211.1.1 (A:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee lghrdvarylraaaggtrgsnharidaaegpsdipd
Timeline for d2a5ea_: