SCOP 1.57: Domain d1bi7b_: 1bi7 B:

Lineage for d1bi7b_ (1bi7 B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.2: Ankyrin repeat [48403] (1 family)

5. Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)

6. Protein Cell cycle inhibitor p16ink4A [48414] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)

8. Domain d1bi7b_: 1bi7 B: [19166]
   Other proteins in same PDB: d1bi7a_

Details for d1bi7b_

PDB Entry: 1bi7, 3.4 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex

SCOP Domain Sequences for d1bi7b_:

Sequence; same for both SEQRES and ATOM records:

>d1bi7b_ a.118.2.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens)}
epsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarvaellllhgae
pncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaeelghrdvary
lraaa

Timeline for d1bi7b_:

• d1bi7b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bi7b_ appears in SCOP 1.59
  
• d1bi7b_ appears in the current release, SCOPe 2.08