Lineage for d1bu9a_ (1bu9 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) 
Protein p18ink4C(ink6) [48412] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48413] (3 PDB entries) 
Domain d1bu9a_: 1bu9 A: [19165]
Details for d1bu9a_
PDB Entry: 1bu9 (more details)
PDB Description: solution structure of p18-ink4c, 21 structures
SCOP Domain Sequences for d1bu9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bu9a_ a.118.2.1 (A:) p18ink4C(ink6) {Human (Homo sapiens)}
maepwgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrg
anpdlkdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvve
flvkhtasnvghrnhkgdtacdlarlygrnevvslmqangaggatnlq
SCOP Domain Coordinates for d1bu9a_:
Click to download the PDB-style file with coordinates for d1bu9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bu9a_:
- d1bu9a_ appears in SCOP 1.57
- d1bu9a_ appears in the current release, SCOPe 2.08
View in 3D