Lineage for d1g3nf_ (1g3n F:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880274Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 880275Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 880276Family d.211.1.1: Ankyrin repeat [48404] (17 proteins)
  6. 880338Protein p18ink4C(ink6) [48412] (1 species)
  7. 880339Species Human (Homo sapiens) [TaxId:9606] [48413] (6 PDB entries)
  8. 880349Domain d1g3nf_: 1g3n F: [19164]
    Other proteins in same PDB: d1g3na_, d1g3nc1, d1g3nc2, d1g3ne_, d1g3ng1, d1g3ng2

Details for d1g3nf_

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
PDB Compounds: (F:) cyclin-dependent kinase 6 inhibitor

SCOP Domain Sequences for d1g3nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3nf_ d.211.1.1 (F:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]}
gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
tasnvghrnhkgdtacdlarlygrnevvslmqang

SCOP Domain Coordinates for d1g3nf_:

Click to download the PDB-style file with coordinates for d1g3nf_.
(The format of our PDB-style files is described here.)

Timeline for d1g3nf_: