Lineage for d1blxb_ (1blx B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 880274Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 880275Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 880276Family d.211.1.1: Ankyrin repeat [48404] (17 proteins)
  6. 880308Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 880313Species Mouse (Mus musculus) [TaxId:10090] [48411] (1 PDB entry)
  8. 880314Domain d1blxb_: 1blx B: [19160]
    Other proteins in same PDB: d1blxa_
    complexed with ca

Details for d1blxb_

PDB Entry: 1blx (more details), 1.9 Å

PDB Description: p19ink4d/cdk6 complex
PDB Compounds: (B:) p19ink4d

SCOP Domain Sequences for d1blxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blxb_ d.211.1.1 (B:) Cell cycle inhibitor p19ink4D {Mouse (Mus musculus) [TaxId: 10090]}
vcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspavalellkqga
spnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireghssvvsf
lapesdlhhrdasgltplelarqrgaqnlmdilqghmmip

SCOP Domain Coordinates for d1blxb_:

Click to download the PDB-style file with coordinates for d1blxb_.
(The format of our PDB-style files is described here.)

Timeline for d1blxb_: