Lineage for d1blxb_ (1blx B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) Protein Cell cycle inhibitor p19ink4D [48409] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [48411] (1 PDB entry) 
Domain d1blxb_: 1blx B: [19160]
Other proteins in same PDB: d1blxa_
Details for d1blxb_
PDB Entry: 1blx (more details), 1.9 Å
PDB Description: p19ink4d/cdk6 complex
SCOP Domain Sequences for d1blxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blxb_ a.118.2.1 (B:) Cell cycle inhibitor p19ink4D {Mouse (Mus musculus)}
vcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspavalellkqga
spnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireghssvvsf
lapesdlhhrdasgltplelarqrgaqnlmdilqghmmip
SCOP Domain Coordinates for d1blxb_:
Click to download the PDB-style file with coordinates for d1blxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1blxb_:
- d1blxb_ appears in SCOP 1.57
- d1blxb_ appears in the current release, SCOPe 2.08
View in 3D
