Lineage for d1bi8d_ (1bi8 D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1229098Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1229099Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1229100Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1229132Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 1229133Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)
  8. 1229136Domain d1bi8d_: 1bi8 D: [19159]
    Other proteins in same PDB: d1bi8a_, d1bi8c_

Details for d1bi8d_

PDB Entry: 1bi8 (more details), 2.8 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex
PDB Compounds: (D:) cyclin-dependent kinase inhibitor

SCOPe Domain Sequences for d1bi8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi8d_ d.211.1.1 (D:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]}
vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga
spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf
laaesdlhrrdargltplelalqrgaqdlvdilqg

SCOPe Domain Coordinates for d1bi8d_:

Click to download the PDB-style file with coordinates for d1bi8d_.
(The format of our PDB-style files is described here.)

Timeline for d1bi8d_: