Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (1 family) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (16 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Cell cycle inhibitor p19ink4D [48409] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries) |
Domain d1bi8b_: 1bi8 B: [19158] Other proteins in same PDB: d1bi8a_, d1bi8c_ |
PDB Entry: 1bi8 (more details), 2.8 Å
SCOP Domain Sequences for d1bi8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi8b_ d.211.1.1 (B:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens)} vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf laaesdlhrrdargltplelalqrgaqdlvdilqg
Timeline for d1bi8b_: