Lineage for d1bi8b_ (1bi8 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 338069Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 338070Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 338071Family d.211.1.1: Ankyrin repeat [48404] (12 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 338090Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 338091Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)
  8. 338093Domain d1bi8b_: 1bi8 B: [19158]
    Other proteins in same PDB: d1bi8a_, d1bi8c_

Details for d1bi8b_

PDB Entry: 1bi8 (more details), 2.8 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex

SCOP Domain Sequences for d1bi8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi8b_ d.211.1.1 (B:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens)}
vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga
spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf
laaesdlhrrdargltplelalqrgaqdlvdilqg

SCOP Domain Coordinates for d1bi8b_:

Click to download the PDB-style file with coordinates for d1bi8b_.
(The format of our PDB-style files is described here.)

Timeline for d1bi8b_: