Lineage for d1bd8__ (1bd8 -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100649Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 100650Family a.118.2.1: Ankyrin repeat [48404] (10 proteins)
  6. 100666Protein Cell cycle inhibitor p19ink4D [48409] (2 species)
  7. 100667Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)
  8. 100668Domain d1bd8__: 1bd8 - [19157]

Details for d1bd8__

PDB Entry: 1bd8 (more details), 1.8 Å

PDB Description: structure of cdk inhibitor p19ink4d

SCOP Domain Sequences for d1bd8__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bd8__ a.118.2.1 (-) Cell cycle inhibitor p19ink4D {Human (Homo sapiens)}
ragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqgas
pnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsfl
aaesdlhrrdargltplelalqrgaqdlvdilqghm

SCOP Domain Coordinates for d1bd8__:

Click to download the PDB-style file with coordinates for d1bd8__.
(The format of our PDB-style files is described here.)

Timeline for d1bd8__: