SCOPe 2.05: Domain d1e90a1: 1e90 A:525-725

Lineage for d1e90a1 (1e90 A:525-725)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [48401] (5 PDB entries)

8. Domain d1e90a1: 1e90 A:525-725 [19150]
   Other proteins in same PDB: d1e90a2, d1e90a3, d1e90a4
   complexed with myc

Details for d1e90a1

PDB Entry: 1e90, 2.7 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine

PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1e90a1:

Sequence, based on SEQRES records:

>d1e90a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d1e90a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialpempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssvkwg
qqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
ylrgcg

Timeline for d1e90a1:

• d1e90a1 first appeared (with stable ids) in SCOP 1.55
  
• d1e90a1 appears in SCOPe 2.04
  
• d1e90a1 appears in SCOPe 2.06
  
• d1e90a1 appears in the current release, SCOPe 2.08