Lineage for d1am4b_ (1am4 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542636Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 542637Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) (S)
  5. 542638Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (5 proteins)
    Pfam 00620
  6. 542649Protein p50 RhoGAP domain [48352] (1 species)
  7. 542650Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries)
  8. 542655Domain d1am4b_: 1am4 B: [19101]
    Other proteins in same PDB: d1am4d_, d1am4e_, d1am4f_

Details for d1am4b_

PDB Entry: 1am4 (more details), 2.7 Å

PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)

SCOP Domain Sequences for d1am4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1am4b_ a.116.1.1 (B:) p50 RhoGAP domain {Human (Homo sapiens)}
prpplpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvre
vqqkynmglpvdfdqynelhlpavilktflrelpeplltfdlyphvvgflnidesqrvpa
tlqvlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlka
inpintftkflldhqgelf

SCOP Domain Coordinates for d1am4b_:

Click to download the PDB-style file with coordinates for d1am4b_.
(The format of our PDB-style files is described here.)

Timeline for d1am4b_: