Lineage for d1dg3a1 (1dg3 A:284-583)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542585Fold a.114: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48339] (1 superfamily)
    multihelical; bundle of longer and shorter helices
  4. 542586Superfamily a.114.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48340] (1 family) (S)
  5. 542587Family a.114.1.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48341] (1 protein)
  6. 542588Protein Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48342] (1 species)
  7. 542589Species Human (Homo sapiens) [TaxId:9606] [48343] (2 PDB entries)
  8. 542591Domain d1dg3a1: 1dg3 A:284-583 [19078]
    Other proteins in same PDB: d1dg3a2

Details for d1dg3a1

PDB Entry: 1dg3 (more details), 1.8 Å

PDB Description: structure of human guanylate binding protein-1 in nucleotide free form

SCOP Domain Sequences for d1dg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg3a1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens)}
ggiqvngprleslvltyvnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkv
qlpteslqelldlhrdsereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeas
sdrcsgllqvifspleeevkagiyskpggyrlfvqklqdlkkkyyeeprkgiqaeeilqt
ylkskesmtdailqtdqtltekekeievervkaesaqasakmlhemqrkneqmmeqkers
yqehlkqltekmendrvqllkeqertlalklqeqeqllkegfqkesrimkneiqdlqtkm

SCOP Domain Coordinates for d1dg3a1:

Click to download the PDB-style file with coordinates for d1dg3a1.
(The format of our PDB-style files is described here.)

Timeline for d1dg3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dg3a2