Lineage for d1e3mb1 (1e3m B:270-566)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095471Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 1095472Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 1095473Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 1095474Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 1095475Species Escherichia coli [TaxId:562] [48338] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1095480Domain d1e3mb1: 1e3m B:270-566 [19076]
    Other proteins in same PDB: d1e3ma2, d1e3ma3, d1e3ma4, d1e3mb2, d1e3mb3, d1e3mb4
    complexed with adp, mg

Details for d1e3mb1

PDB Entry: 1e3m (more details), 2.2 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:t mismatch
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1e3mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3mb1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d1e3mb1:

Click to download the PDB-style file with coordinates for d1e3mb1.
(The format of our PDB-style files is described here.)

Timeline for d1e3mb1: