SCOPe 2.06: Domain d1dd4b1: 1dd4 B:1-57

Lineage for d1dd4b1 (1dd4 B:1-57)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
   multihelical; intertwined tetramer

4. Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family)

5. Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)

6. Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries)

8. Domain d1dd4b1: 1dd4 B:1-57 [19036]
   Other proteins in same PDB: d1dd4a2, d1dd4b2
   complexed with tbr

Details for d1dd4b1

PDB Entry: 1dd4, 2.4 Å

PDB Description: Crystal structure of ribosomal protein l12 from thermotoga maritim

PDB Compounds: (B:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1dd4b1:

Sequence; same for both SEQRES and ATOM records:

>d1dd4b1 a.108.1.1 (B:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

Timeline for d1dd4b1:

• d1dd4b1 first appeared (with stable ids) in SCOP 1.55
  
• d1dd4b1 appears in SCOPe 2.05
  
• d1dd4b1 appears in SCOPe 2.07
  
• d1dd4b1 appears in the current release, SCOPe 2.08