Class a: All alpha proteins [46456] (284 folds) |
Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily) multihelical; intertwined tetramer |
Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) |
Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein) |
Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species) |
Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries) |
Domain d1dd4b1: 1dd4 B:1-57 [19036] Other proteins in same PDB: d1dd4a2, d1dd4b2 complexed with tbr |
PDB Entry: 1dd4 (more details), 2.4 Å
SCOPe Domain Sequences for d1dd4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dd4b1 a.108.1.1 (B:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]} mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt
Timeline for d1dd4b1:
View in 3D Domains from other chains: (mouse over for more information) d1dd4a1, d1dd4a2, d1dd4c_, d1dd4d_ |