SCOPe 2.03: Domain d1wrpr_: 1wrp R:

Lineage for d1wrpr_ (1wrp R:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (3 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (1 protein)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein Trp repressor, TrpR [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (14 PDB entries)

8. Domain d1wrpr_: 1wrp R: [19016]
   complexed with trp

Details for d1wrpr_

PDB Entry: 1wrp, 2.2 Å

PDB Description: flexibility of the dna-binding domains of trp repressor

PDB Compounds: (R:) trp repressor

SCOPe Domain Sequences for d1wrpr_:

Sequence; same for both SEQRES and ATOM records:

>d1wrpr_ a.4.12.1 (R:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnslkaapvelrqwleevll

Timeline for d1wrpr_:

• d1wrpr_ first appeared (with stable ids) in SCOP 1.55
  
• d1wrpr_ appears in SCOPe 2.02
  
• d1wrpr_ appears in SCOPe 2.04
  
• d1wrpr_ appears in the current release, SCOPe 2.08