Lineage for d1etqd_ (1etq D:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438452Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 438457Protein FIS protein [48285] (1 species)
    includes N-terminal dimerisation subdomain
  7. 438458Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)
  8. 438484Domain d1etqd_: 1etq D: [19003]

Details for d1etqd_

PDB Entry: 1etq (more details), 2.8 Å

PDB Description: the crystal structure of e. coli fis mutant r71y

SCOP Domain Sequences for d1etqd_:

Sequence, based on SEQRES records: (download)

>d1etqd_ a.4.1.12 (D:) FIS protein {Escherichia coli}
vltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqy
tygnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etqd_ a.4.1.12 (D:) FIS protein {Escherichia coli}
vltvstqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytygnqtra
almmginrgtlrkklkkygmn

SCOP Domain Coordinates for d1etqd_:

Click to download the PDB-style file with coordinates for d1etqd_.
(The format of our PDB-style files is described here.)

Timeline for d1etqd_: