Lineage for d1etqc_ (1etq C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5824Fold a.105: FIS-like [48282] (1 superfamily)
  4. 5825Superfamily a.105.1: FIS-like [48283] (1 family) (S)
  5. 5826Family a.105.1.1: FIS-like [48284] (2 proteins)
  6. 5831Protein FIS protein [48285] (1 species)
  7. 5832Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)
  8. 5857Domain d1etqc_: 1etq C: [19002]

Details for d1etqc_

PDB Entry: 1etq (more details), 2.8 Å

PDB Description: the crystal structure of e. coli fis mutant r71y
PDB Compounds: (C:)

SCOP Domain Sequences for d1etqc_:

Sequence, based on SEQRES records: (download)

>d1etqc_ a.105.1.1 (C:) FIS protein {Escherichia coli}
ltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqyt
ygnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etqc_ a.105.1.1 (C:) FIS protein {Escherichia coli}
ltvkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytygnqtraalmm
ginrgtlrkklkkygmn

SCOP Domain Coordinates for d1etqc_:

Click to download the PDB-style file with coordinates for d1etqc_.
(The format of our PDB-style files is described here.)

Timeline for d1etqc_: