Lineage for d3fisa_ (3fis A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5824Fold a.105: FIS-like [48282] (1 superfamily)
  4. 5825Superfamily a.105.1: FIS-like [48283] (1 family) (S)
  5. 5826Family a.105.1.1: FIS-like [48284] (2 proteins)
  6. 5831Protein FIS protein [48285] (1 species)
  7. 5832Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)
  8. 5849Domain d3fisa_: 3fis A: [18994]

Details for d3fisa_

PDB Entry: 3fis (more details), 2.3 Å

PDB Description: the molecular structure of wild-type and a mutant fis protein: relationship between mutational changes and recombinational enhancer function or dna binding
PDB Compounds: (A:)

SCOP Domain Sequences for d3fisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fisa_ a.105.1.1 (A:) FIS protein {Escherichia coli}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraalmmginr
gtlrkklkkygmn

SCOP Domain Coordinates for d3fisa_:

Click to download the PDB-style file with coordinates for d3fisa_.
(The format of our PDB-style files is described here.)

Timeline for d3fisa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3fisb_