SCOP 1.69: Domain d1etka_: 1etk A:

Lineage for d1etka_ (1etk A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.12: FIS-like [100918] (4 proteins)

6. Protein FIS protein [48285] (1 species)
   includes N-terminal dimerisation subdomain

7. Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)

8. Domain d1etka_: 1etk A: [18992]

Details for d1etka_

PDB Entry: 1etk, 2.1 Å

PDB Description: the crystal structure of e. coli fis mutant q68a

SCOP Domain Sequences for d1etka_:

Sequence, based on SEQRES records:

>d1etka_ a.4.1.12 (A:) FIS protein {Escherichia coli}
dvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvma
ytrgnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records):

>d1etka_ a.4.1.12 (A:) FIS protein {Escherichia coli}
dvltvkplrdsvkqalknyfaqlvndlyelvlaeveqplldmvmaytrgnqtraalmmgi
nrgtlrkklkkygmn

Timeline for d1etka_:

• d1etka_ first appeared (with stable ids) in SCOP 1.55
  
• d1etka_ appears in SCOP 1.67
  
• d1etka_ appears in SCOP 1.71
  
• d1etka_ appears in the current release, SCOPe 2.08