Lineage for d1etvb_ (1etv B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50275Fold a.105: FIS-like [48282] (1 superfamily)
  4. 50276Superfamily a.105.1: FIS-like [48283] (1 family) (S)
  5. 50277Family a.105.1.1: FIS-like [48284] (2 proteins)
  6. 50282Protein FIS protein [48285] (1 species)
  7. 50283Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)
  8. 50291Domain d1etvb_: 1etv B: [18987]

Details for d1etvb_

PDB Entry: 1etv (more details), 2 Å

PDB Description: the crystal structure of e. coli fis mutant g72a

SCOP Domain Sequences for d1etvb_:

Sequence, based on SEQRES records: (download)

>d1etvb_ a.105.1.1 (B:) FIS protein {Escherichia coli}
rvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplld
mvmqytranqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etvb_ a.105.1.1 (B:) FIS protein {Escherichia coli}
rvnsdvltvkplrdsvkqalknyfaqqdvndlyelvlaeveqplldmvmqytranqtraa
lmmginrgtlrkklkkygmn

SCOP Domain Coordinates for d1etvb_:

Click to download the PDB-style file with coordinates for d1etvb_.
(The format of our PDB-style files is described here.)

Timeline for d1etvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1etva_