Lineage for d1etob_ (1eto B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5824Fold a.105: FIS-like [48282] (1 superfamily)
  4. 5825Superfamily a.105.1: FIS-like [48283] (1 family) (S)
  5. 5826Family a.105.1.1: FIS-like [48284] (2 proteins)
  6. 5831Protein FIS protein [48285] (1 species)
  7. 5832Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)
  8. 5838Domain d1etob_: 1eto B: [18983]

Details for d1etob_

PDB Entry: 1eto (more details), 1.9 Å

PDB Description: the crystal structure of e. coli fis mutant r71l
PDB Compounds: (B:)

SCOP Domain Sequences for d1etob_:

Sequence, based on SEQRES records: (download)

>d1etob_ a.105.1.1 (B:) FIS protein {Escherichia coli}
mfeqrvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveq
plldmvmqytlgnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etob_ a.105.1.1 (B:) FIS protein {Escherichia coli}
mfeqrvnsdvltvstvqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplld
mvmqytlgnqtraalmmginrgtlrkklkkygmn

SCOP Domain Coordinates for d1etob_:

Click to download the PDB-style file with coordinates for d1etob_.
(The format of our PDB-style files is described here.)

Timeline for d1etob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1etoa_