SCOP 1.67: Domain d1fipa_: 1fip A:

Lineage for d1fipa_ (1fip A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (12 families)
   consists only of helices

5. Family a.4.1.12: FIS-like [100918] (4 proteins)

6. Protein FIS protein [48285] (1 species)
   includes N-terminal dimerisation subdomain

7. Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)

8. Domain d1fipa_: 1fip A: [18980]

Details for d1fipa_

PDB Entry: 1fip, 1.9 Å

PDB Description: the structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue

SCOP Domain Sequences for d1fipa_:

Sequence; same for both SEQRES and ATOM records:

>d1fipa_ a.4.1.12 (A:) FIS protein {Escherichia coli}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
gtlrkklkkygmn

Timeline for d1fipa_:

• d1fipa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fipa_ appears in SCOP 1.65
  
• d1fipa_ appears in SCOP 1.69
  
• d1fipa_ appears in the current release, SCOPe 2.08