SCOP 1.65: Domain d1fipa_: 1fip A:

Lineage for d1fipa_ (1fip A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.105: FIS-like [48282] (1 superfamily)
   multihelical; intertwined dimer of identical 4-helical subunits

4. Superfamily a.105.1: FIS-like [48283] (1 family)

5. Family a.105.1.1: FIS-like [48284] (2 proteins)

6. Protein FIS protein [48285] (1 species)

7. Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)

8. Domain d1fipa_: 1fip A: [18980]

Details for d1fipa_

PDB Entry: 1fip, 1.9 Å

PDB Description: the structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue

SCOP Domain Sequences for d1fipa_:

Sequence; same for both SEQRES and ATOM records:

>d1fipa_ a.105.1.1 (A:) FIS protein {Escherichia coli}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
gtlrkklkkygmn

Timeline for d1fipa_:

• d1fipa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fipa_ appears in SCOP 1.63
  
• d1fipa_ appears in SCOP 1.67
  
• d1fipa_ appears in the current release, SCOPe 2.08