SCOPe 2.08: Domain d1fipa_: 1fip A:

Lineage for d1fipa_ (1fip A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.12: FIS-like [100918] (4 proteins)

6. Protein FIS protein [48285] (2 species)
   includes N-terminal dimerisation subdomain

7. Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)

8. Domain d1fipa_: 1fip A: [18980]
   mutant

Details for d1fipa_

PDB Entry: 1fip, 1.9 Å

PDB Description: the structure of fis mutant pro61ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue

PDB Compounds: (A:) factor for inversion stimulation (fis)

SCOPe Domain Sequences for d1fipa_:

Sequence; same for both SEQRES and ATOM records:

>d1fipa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqalldmvmqytrgnqtraalmmginr
gtlrkklkkygmn

Timeline for d1fipa_:

• d1fipa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fipa_ appears in SCOPe 2.07