Lineage for d1etxb_ (1etx B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284698Fold a.105: FIS-like [48282] (1 superfamily)
    multihelical; intertwined dimer of identical 4-helical subunits
  4. 284699Superfamily a.105.1: FIS-like [48283] (1 family) (S)
  5. 284700Family a.105.1.1: FIS-like [48284] (2 proteins)
  6. 284705Protein FIS protein [48285] (1 species)
  7. 284706Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)
  8. 284708Domain d1etxb_: 1etx B: [18979]
    mutant

Details for d1etxb_

PDB Entry: 1etx (more details), 1.9 Å

PDB Description: the crystal structure of e. coli fis mutant q74a

SCOP Domain Sequences for d1etxb_:

Sequence, based on SEQRES records: (download)

>d1etxb_ a.105.1.1 (B:) FIS protein {Escherichia coli}
rvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplld
mvmqytrgnatraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etxb_ a.105.1.1 (B:) FIS protein {Escherichia coli}
rvnsdvltvkplrdsvkqalknyfaqdvndlyelvlaeveqplldmvmqytrgnatraal
mmginrgtlrkklkkygmn

SCOP Domain Coordinates for d1etxb_:

Click to download the PDB-style file with coordinates for d1etxb_.
(The format of our PDB-style files is described here.)

Timeline for d1etxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1etxa_