Lineage for d1etxb_ (1etx B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692555Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 2692560Protein FIS protein [48285] (2 species)
    includes N-terminal dimerisation subdomain
  7. 2692588Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)
  8. 2692600Domain d1etxb_: 1etx B: [18979]
    mutant

Details for d1etxb_

PDB Entry: 1etx (more details), 1.9 Å

PDB Description: the crystal structure of e. coli fis mutant q74a
PDB Compounds: (B:) factor for inversion stimulation

SCOPe Domain Sequences for d1etxb_:

Sequence, based on SEQRES records: (download)

>d1etxb_ a.4.1.12 (B:) FIS protein {Escherichia coli [TaxId: 562]}
rvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplld
mvmqytrgnatraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etxb_ a.4.1.12 (B:) FIS protein {Escherichia coli [TaxId: 562]}
rvnsdvltvkplrdsvkqalknyfaqdvndlyelvlaeveqplldmvmqytrgnatraal
mmginrgtlrkklkkygmn

SCOPe Domain Coordinates for d1etxb_:

Click to download the PDB-style file with coordinates for d1etxb_.
(The format of our PDB-style files is described here.)

Timeline for d1etxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1etxa_